PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000102.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 493aa    MW: 54103.1 Da    PI: 4.3903
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000102.1_g00019.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.83.7e-481192452128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              + Gf+FhPtdeelvv++L++kv ++++++ e+i+evdiy++ePw+L+   +v+++e ew+fF++++kky +g++ nrat +g+Wka
  Itr_sc000102.1_g00019.1 119 AYGFKFHPTDEELVVYFLRRKVLRRPFPF-EAIAEVDIYNFEPWELQgFcAVDSREAEWHFFTRTEKKYINGSKINRATINGFWKA 203
                              67***************************.89**************95347778888***************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tg+d++v++ k++ vglkktLv++ grap g++tdW+mheyrl
  Itr_sc000102.1_g00019.1 204 TGRDRAVHH-KSQIVGLKKTLVYHAGRAPAGKRTDWLMHEYRL 245
                              *********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-53108269IPR003441NAC domain
PROSITE profilePS5100552.005118269IPR003441NAC domain
PfamPF023653.3E-23120245IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MAAAEEQTVV AAAAEEQPVV AAMDEGMAAE EQQVVAAIGE GAQEQAQAQA QAETETPFVA  60
VMGEGSQAQA QTEAPFVAAM GERSQAQAQA EAPFVAAMGE GSQAQAPFVA AMMPKPKLAY  120
GFKFHPTDEE LVVYFLRRKV LRRPFPFEAI AEVDIYNFEP WELQGFCAVD SREAEWHFFT  180
RTEKKYINGS KINRATINGF WKATGRDRAV HHKSQIVGLK KTLVYHAGRA PAGKRTDWLM  240
HEYRLSEQEL DKAGVQQKDA YYICKVYLKK DAMGRRGVPF NVEDWENHTG ILIPCEDNNA  300
EDEASEVNLQ GGSTSKAVQL PEKAQGFKSL RIRAREEDDD DTDDDDDETE DDEAIVCLDK  360
GKKPKLMLDF FSGAGGKGDS DDDSSSATIS DSLTPDFSSG PLNFSLTAKP KEKENRGSAA  420
PNNAGGAFNS SCLENSLPPG YLKFITDLEE ERDSLKHQLM NSEATVSCLQ AENEEMAEEI  480
MRLRSLLPGQ GSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-4111827115170Stress-induced transcription factor NAC1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.12e-65NAC domain containing protein 52